EGF, rat recombinant

Catalog number
4024-20
Name
EGF, rat recombinant
Size
20 μg
Price
142.00 EUR
Supplier

Details

Target
EGF
Background
Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Epidermal Growth Factor Rat Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 53 amino acids and having a molecular mass of 6151 Dalton. The Rat EGF is purified by proprietary chromatographic techniques.
Concentration
N/A
Molecular weight
6.151 kDa
Synonym
Urogastrone, URG, EGF, epidermal growth factor
Other name
Urogastrone, URG, EGF, epidermal growth factor
NCBI gene number
Rn. 6075
NCBI gene
EGF
Gene source
Rat
NCBI number
P07522
Recombinant
Yes
Source
E. coli
Purification
≥98%
Tested applications
SDS-PAGE, HPLC
Level of endotoxin
N/A
Tested activity
N/A
Biological activity
The ED₅₀ as calculated by the dose-dependant proliferation of murine BALB/c 3T3 cells is less than 0.1ng/ml, corresponding to a specific activity of> 1 x 10⁷units/mg.
Binding ability
N/A
Unit
N/A
Storage condition
-20°C
Shipping under
Gel pack
Physical appearance
Lyophilized protein
Physical properties
Lyophilized from PBS, pH 7.4
How to reconstitute
Centrifuge the vial prior to opening. Reconstitute in sterile H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffer.
Aa sequence
NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
Before use
Centrifuge the vial prior to opening.
Notes
For Research Use Only! Not to be used in humans
About
Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
Latin name
Rattus norvegicus
Additional source
Recombinants or rec. proteins
Group
recombinants