CNTF, rat recombinant

Catalog number
4019-1000
Name
CNTF, rat recombinant
Size
1 mg
Price
3313.00 EUR
Supplier

Details

Target
CNTF
Background
CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. CNTF is a survival factor for various neuronal cell types and seems to prevent the degeneration of motor axons after axotomy. CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques.
Concentration
N/A
Molecular weight
22.834 kDa
Synonym
HCNTF, CNTF, Ciliary Neurotrophic Factor.
Other name
HCNTF, CNTF, Ciliary Neurotrophic Factor.
NCBI gene number
1270
NCBI gene
CNTF
Gene source
Human
NCBI number
P26441
Recombinant
Yes
Source
E. coli
Purification
≥99%
Tested applications
SDS-PAGE, HPLC
Level of endotoxin
N/A
Tested activity
N/A
Biological activity
Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
Reesults
N/A
Binding ability
N/A
Unit
N/A
Storage condition
-20°C
Shipping under
Gel pack
Physical appearance
Lyophilized protein
Physical properties
Lyophilized from 0.025 % NaHCO₃
How to reconstitute
Centrifuge the vial prior to opening. Reconstitute in sterile ddH₂O or 0.4 % NaHCO₃ adjusted to pH 8-9 to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffer, preferably in the presence of carrier protein.
Aa sequence
AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Before use
Centrifuge the vial prior to opening.
Notes
For Research Use Only! Not to be used in humans
About
Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
Latin name
Rattus norvegicus
Additional source
Recombinants or rec. proteins
Group
recombinants