PACAP (human, chicken, mouse, ovine, porcine, rat) (6-38)

Pituitary Adenylate Cyclase Activating Polypeptide-38 (6-38); FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂

Lyophilized solid

N/A

143748-18-9

H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂

C₁₈₂H₃₀₀N₅₆O₄₅S

4024.8

≥95%

H₂O (~ 2 mg/ml)

Protect from air and moisture

A potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist

-20°C

Gel Pack

36 months

N/A

N/A

Biochemicals

Chickens like all bird species have IgY antibodies that are very stable and found in the yolk. Gallus Gallus domestica is the Latin name of the Chicken.Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.

Mus musculus,Rattus norvegicus

Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.