Human CellExp™ Cathepsin S, human recombinant

Catalog number
7277-1000
Name
Human CellExp™ Cathepsin S, human recombinant
Size
1 mg
Price
8223.00 EUR
Supplier

Details

Target
Cathepsin S
Background
Cathepsin S (CTSS) is a lysosomal cysteine protease of the papain family and may participate in the degradation of antigenic proteins to peptides for presentation on MHC class II molecules. CTSS is synthesized as inactive precursor of 331 amino acids consisting of a 15-aa signal peptide, a propeptide of 99 aa, and a mature polypeptide of 217 aa. It is activated in the lysosomes by a proteolytic cleavage of the propeptide. The deduced amino acid sequence contains only one potential N-glycosylation site located in the propeptide. Compared with the abundant cathepsins B, L and H, cathepsin S shows a restricted tissue distribution, with highest levels in spleen, heart, and lung. In addition, evidences indicated that cathepsin S generates A beta from amyloidogenic fragments of beta APP in the endosomal/lysosomal compartment, and is implicated in the pathogenesis of Alzheimer’s disease (AD) and Down Syndrome (DS).
Concentration
0.2 μM
Molecular weight
~ 37 kDa
Synonym
Cathepsin S, CTSS
Other name
Cathepsin S, CTSS
NCBI gene number
1520
NCBI gene
CTSS
Gene source
Human
NCBI number
P25774
Recombinant
Yes
Source
HEK 293 cells
Purification
≥95%
Tested applications
SDS-PAGE, SEC-HPLC
Tested activity
>1000 mU (1U = 1 µmole/min/mg) as determined by Cathepsin S Activity Assay Kit (K144-100).
Biological activity
>1000 mU (1U = 1 µmole/min/mg) as determined by Cathepsin S Activity Assay Kit (K144-100).
Reesults
>1000 mU (1U = 1 µmole/min/mg) .
Binding ability
N/A
Unit
N/A
Storage condition
-80°C
Shipping under
Dry Ice
Physical appearance
Liquid
Physical properties
A 0.2 μM filtered solution of 20mM MES, 150mM NaCl, 10% Glycerol, pH 5.5.
How to reconstitute
N/A
Aa sequence
QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNWILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIVDHHHHHH
Before use
Centrifuge the vial prior to opening.
Notes
For Research Use Only! Not to be used in humans
Gene
CTS protease activity also measured by zymograph electrophoresis of Cathepsins. This cathepsin is supplied in 1.
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Additional source
Recombinants or rec. proteins
Group
recombinants